skin & body skin care

(47 Items)

100570 412067 412067 1 Glyco-Lacto Peel 1.69 Fl. Oz. Skin Regimen Skin Regimen Glyco-Lacto Peel 1.69 Fl. Oz. False skinregimen/czsrglycolactopeel1oz.jpg Special Offer Available 45.50 45.50 27.30 True True False False 27.30 False False Diversion contract is required 0 Skin Regimen Glyco-Lacto Peel renewing mask is homecare peeling for an effective and progressive skin renewal. True Log in to view pricing. False

Skin Regimen
Glyco-Lacto Peel

1.69 Fl. Oz.

SKU 412067

Promotional ItemLog in to view pricing.
Quick View
39074 410991 410991 1 Corrector 0.5 Fl. Oz. Comfort Zone Comfort Zone Active Pureness Corrector 0.5 Fl. Oz. False comfortzone/activepurenesscorrectorretail.jpg Special Offer Available 20.00 20.00 20.00 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Active Pureness Corrector is a targeted imperfection corrector for skin blemishes and acne prone skin. True Log in to view pricing. False

Comfort Zone
Active Pureness Corrector

0.5 Fl. Oz.

SKU 410991

Log in to view pricing.
Quick View
68043 420558 420558 1 Acid Preparator 10.14 Fl. Oz. Comfort Zone Professional Comfort Zone Professional Essential Acid Preparator 10.14 Fl. Oz. False comfortzoneprofessional/czsublimeacid.jpg Special Offer Available 37.50 37.50 37.50 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Essential Acid Preparator. False Log in to view pricing. False

Comfort Zone Professional
Essential Acid Preparator

10.14 Fl. Oz.

SKU 420558

Log in to view pricing.
Quick View
39212 420437 420437 1 Recover Touch Mask 8.45 Fl. Oz. Comfort Zone Professional Comfort Zone Professional Renight Recover Touch Mask 8.45 Fl. Oz. False comfortzone/recovertouchmask.jpg Special Offer Available 38.00 38.00 38.00 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Renight Recover Touch Mask is a nourishing vitamin mask. True Log in to view pricing. False

Comfort Zone Professional
Renight Recover Touch Mask

8.45 Fl. Oz.

SKU 420437

Log in to view pricing.
Quick View
126744 420716 420716 1 Neutralizer 9.47 Fl. Oz. Comfort Zone Professional Comfort Zone Professional Sublime Skin Neutralizer 9.47 Fl. Oz. False comfortzoneprofessional/comfortzonesublimeskinneutralizer9oz.jpg Special Offer Available 37.50 37.50 37.50 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Professional Sublime Skin Neutralizer is an arginine solution which, due to its affinity with the skin, gently neutralizes the activity of the alpha-hydroxy acids and restores the physiological skin pH. True Log in to view pricing. False

Comfort Zone Professional
Sublime Skin Neutralizer

9.47 Fl. Oz.

SKU 420716

Log in to view pricing.
Quick View
135656 412292 412292 1 Bright & Smooth Ampoule 7 x 0.07 Fl. Oz. Comfort Zone Comfort Zone Renight Bright & Smooth Ampoule 7 x 0.07 Fl. Oz. False comfortzone/comfortzonebrightandsmoothampuleprodid135656.jpg Special Offer Available 25.00 25.00 25.00 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Renight Bright & Smooth Ampoule's offer a nighttime multivitamin concentrate with a smoothing and brightening action for the face and eye area. True Log in to view pricing. False

Comfort Zone
Renight Bright & Smooth Ampoule

7 x 0.07 Fl. Oz.

SKU 412292

Log in to view pricing.
Quick View
136208 412292F 412292F 1 Bright & Smooth Ampoule TESTER 7 x 0.07 Fl. Oz. Comfort Zone Comfort Zone Renight Bright & Smooth Ampoule TESTER 7 x 0.07 Fl. Oz. False comfortzone/comfortzonebrightandsmoothampuleprodid135656.jpg Special Offer Available 18.00 18.00 18.00 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Renight Bright & Smooth Ampoule's offer a nighttime multivitamin concentrate with a smoothing and brightening action for the face and eye area. True Log in to view pricing. False

Comfort Zone
Renight Bright & Smooth Ampoule TESTER

7 x 0.07 Fl. Oz.

SKU 412292F

Log in to view pricing.
Quick View
153751 711462 711462 1 deep acne liquid patch TESTER 0.5 Fl. Oz. Dermalogica Dermalogica active clearing deep acne liquid patch TESTER 0.5 Fl. Oz. False dermalogica/dermalogicadeepacneliquidpatchtester0.5floz.jpg Special Offer Available 16.00 22.40 22.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica active clearing deep acne liquid patch is a sulfur-based, liquid-to-patch spot treatment for painful, cystic acne. True Log in to view pricing. False

Dermalogica
active clearing deep acne liquid patch TESTER

0.5 Fl. Oz.

SKU 711462

Log in to view pricing.
Quick View
119360 811063 811063 1 super rich repair 3.4 Fl. Oz. Dermalogica Dermalogica age smart super rich repair 3.4 Fl. Oz. True dermalogica/811063dermalogicasuperrichrepairtube.jpg Special Offer Available 72.50 101.50 101.50 False False False False 0.00 False False Diversion contract is required 0 Dermalogica super rich repair is a deeply nourishing skin treatment cream. True Log in to view pricing. False

Dermalogica
age smart super rich repair

Log in to view pricing.
View Sizes
127310 111449 111449 1 awaken peptide eye gel 0.5 Fl. Oz. Dermalogica Dermalogica awaken peptide eye gel 0.5 Fl. Oz. False dermalogica/dermalogicaawakenpeptideeyegel05oz.jpg Special Offer Available 29.50 41.30 41.30 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

0.5 Fl. Oz.

SKU 111449

Log in to view pricing.
Quick View
135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE False dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.50 0.70 0.70 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

SAMPLE

SKU 611449

Log in to view pricing.
Quick View
135603 711499 711499 1 awaken peptide eye gel TESTER 0.5 Fl. Oz. Dermalogica Dermalogica awaken peptide eye gel TESTER 0.5 Fl. Oz. False dermalogica/dermalogicaawakenpeptideeyegel05oztester.png Special Offer Available 28.50 39.90 39.90 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel TESTER

0.5 Fl. Oz.

SKU 711499

Log in to view pricing.
Quick View
128123 111447 111447 1 post-breakout fix 0.5 Fl. Oz. Dermalogica Dermalogica clear start post-breakout fix 0.5 Fl. Oz. False dermalogica/dermalogicaclearstartpostbreakoutfix05ozredo.jpg Special Offer Available 12.25 12.25 12.25 False False False False 0.00 False False Diversion contract is required 0 Dermalogica clear start post-breakout fix is a gel spot treatment that helps fade and brighten the post-inflammatory hyperpigmentation (aka red and dark spots) that popping pimples leaves behind. True Log in to view pricing. False

Dermalogica
clear start post-breakout fix

0.5 Fl. Oz.

SKU 111447

Log in to view pricing.
Quick View
42432 111257 111257 1 stress positive eye lift 0.85 Fl. Oz. Dermalogica Dermalogica daily skin health stress positive eye lift 0.85 Fl. Oz. False dermalogica/111257dermalogicastresspositiveeyelifttube.jpg Special Offer Available 37.00 53.20 53.20 False False False False 0.00 False False Diversion contract is required 0 Dermalogica stress positive eye lift is a de-puffing eye treatment and masque. True Log in to view pricing. False

Dermalogica
daily skin health stress positive eye lift

0.85 Fl. Oz.

SKU 111257

Log in to view pricing.
Quick View
147132 111462 111462 1 deep acne invisible liquid patch 0.5 Fl. Oz. Dermalogica Dermalogica deep acne invisible liquid patch 0.5 Fl. Oz. False dermalogica/dermalogicadeepacneinvisibleliquidpatch.jpg Special Offer Available 17.00 23.80 23.80 False False False False 0.00 False False Diversion contract is required 0 Dermalogica deep acne invisible liquid patch is an invisible sulfur-based spot treatment transforms from liquid to patch to soothe, clear, and help prevent future breakouts. True Log in to view pricing. False

Dermalogica
deep acne invisible liquid patch

0.5 Fl. Oz.

SKU 111462

Log in to view pricing.
Quick View